PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013624432.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 233aa    MW: 26509.1 Da    PI: 9.8049
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013624432.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.91.7e-11853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g+W   Ede l+ a  ++G+++W +I++    ++++kqck rw+ +l
   XP_013624432.1  8 GAWKNTEDEVLKAAMMKYGKNQWGRISSLSV-RKSAKQCKARWNEWL 53
                     79*****************************.************986 PP

2Myb_DNA-binding37.17.1e-1260103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k l++  W+tIa  +g  Rt+ qc +r+ k+l
   XP_013624432.1  60 TEWTVEEDEKLLHLAKILPTQ-WRTIAPAVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.952253IPR017930Myb domain
SMARTSM007172.6E-11655IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-17861IPR009057Homeodomain-like
CDDcd001671.03E-8953No hitNo description
PfamPF139211.3E-111070No hitNo description
SuperFamilySSF466893.33E-2033104IPR009057Homeodomain-like
PROSITE profilePS5129421.13454107IPR017930Myb domain
CDDcd116597.57E-3055104No hitNo description
SMARTSM007171.6E-1258105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-1462104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MRNMVKGGAW KNTEDEVLKA AMMKYGKNQW GRISSLSVRK SAKQCKARWN EWLDPSIKKT  60
EWTVEEDEKL LHLAKILPTQ WRTIAPAVGR TPSQCLERYE KLLDASSCGK GYEAGWKLRP  120
GEIDPNAESK PARPDPVDME DDEMEMLSEA RAKLANTRGK KAKRKAREKQ IQEARSLASL  180
QKRRELIAAG IDDGKHRNRK GKGIDYSAEI AFEKRAPAGF YDTADEDRHA DDH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-9242213236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013624432.11e-172PREDICTED: cell division cycle 5-like protein
SwissprotP929481e-123CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A0D3A4F21e-172A0A0D3A4F2_BRAOL; Uncharacterized protein
STRINGBra027160.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16532913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.11e-118cell division cycle 5